Νέα περιοχή οδικού Zhuqiao Pudong Jinshun No.8, Σαγκάη, Κίνα
Αρχική Σελίδα ΠροϊόνταΕκχύσιμα πεπτίδια

Πεπτίδια cjc-1295 οικοδόμησης μυών χωρίς DAC για Bodybuilders

Πεπτίδια cjc-1295 οικοδόμησης μυών χωρίς DAC για Bodybuilders

    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
    • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders
  • Muscle Building Peptides CJC-1295 Without DAC for Bodybuilders

    Λεπτομέρειες:

    Τόπος καταγωγής: Σαγκάη
    Μάρκα: FILTER
    Πιστοποίηση: GMP
    Αριθμό μοντέλου: API

    Πληρωμής & Αποστολής Όροι:

    Ποσότητα παραγγελίας min: 10 φιαλίδια
    Τιμή: USD 4~8 per vial
    Συσκευασία λεπτομέρειες: 2mg, 5mg/vial, 10mg/vial ή όπως απαιτείται
    Χρόνος παράδοσης: Εντός προθεσμίας 3 εργάσιμων ημερών
    Όροι πληρωμής: L/C, T/T, , MoneyGram, Payneer
    Δυνατότητα προσφοράς: 100,000VIALS/MONTH
    Επικοινωνία
    Λεπτομερής Περιγραφή Προϊόντος
    Προδιαγραφή: 2mg/vial Εμφάνιση: άσπρη σκόνη
    DeliveryTime: μέσα 3~7 στις εργάσιμες ημέρες Θύρα: Σαγκάη/Shenzhen/Χογκ Κογκ
    συσκευασία: Icebag, διακριτικοί τρόποι συσκευασίας για την αναφορά σας LimitNum: 10 φιαλίδια
    Καθαρότητας: 99% Μεταφορά: DHL, Fedix, HKEMS, HKEUB, TNT
    Αποθήκευση: ξηρά, σκοτεινή και αερισμένη θέση, (dogree 2~8)
    Υψηλό φως:

    peptides bodybuilding supplements

    ,

    human growth peptides

    Cjc-1295 με DAC

    Όνομα προϊόντων: CJC1295 DAC CJC1295 με DAC
    Αλλιώς: CJC1295 (GHRH/DAC)
    Ακολουθία: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys (Maleimidopropionyl) - NH2 (συγγένεια σύνθετη)
    Πυκνότητα: 1.45
    Cjc-1295 με DAC
    Τύπος: Άνοση λειτουργία AgentsGrade
    Πρότυπα: Βαθμός ιατρικής
    Ταξινόμηση: Brassinosteroid
    MF: C165H271N47O46
    Μοριακό βάρος: 3649.30
    Αγνότητα (HPLC): 98.0%
    Εμφάνιση: Άσπρη σκόνη
    Ενιαία ακαθαρσία (HPLC): 1.0%
    Σύνθεση αμινοξέος: 10% θεωρητικού
    Περιεκτικότητα σε πεπτίδια (N%): 80% (από %N)
    Περιεκτικότητα σε νερό (Karl Fischer): 6.0%
    Περιεκτικότητα σε οξικό άλας (HPIC): 15.0%
    Μαζική ισορροπία: 95.0~105.0%

    Co. Biotech φίλτρων, ΕΠΕ επιχειρησιακός τομέας:

    Σαν κατασκευαστή πεπτιδίων και στεροειδών, είμαστε για το cOem για τους πελάτες που έχουν τις απαιτήσεις εμπορικών σημάτων. (Επί παραγγελία υπηρεσία).
    Οι υπηρεσίες επιχείρησής μας:

    1. Φαρμακευτικό πεπτίδιο Peptide+Bodubuilding
    2. Καλλυντικό πεπτίδιο
    3. Σκόνη, πετρέλαιο και ετικέττες Sterodis
    4. Επί παραγγελία υπηρεσία

    Ποιος ένας δακτυλογραφεί τους πελάτες σας προτιμά;

     

    Περιγραφή
    Όνομα προϊόντων: CJC1295
    Συνώνυμα: CJC1295 Υ (Δ - Α) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-δίυδρο-2,5-dioxo-1H-pyrrol-1) - 1-oxopropyl] - λ-Lysinamide Cjc-1295 οξικό άλας CJC1295 με έξω DAC
    CAS: 863288-34-0
    MF: C159H258N46O45
    MW: 0
    EINECS:  
    Κατηγορίες προϊόντων: Πεπτίδια


    Η διαδικασία μας:
    Η διαδικασία ποιοτικού ελέγχου
    1) Αγορά
    Η λεπτομερής έρευνα αγοράς, καταλαβαίνει την τιμή των πρώτων υλών και της απόδοσης. Στην πηγή προμήθειας που καταλαβαίνει πλήρως, και που εξασφαλίζει πλήρως την ποιότητα της προμήθειας των πρώτων υλών.


    2) Επιθεώρηση
    Τέσσερα βήματα: δειγματοληψία, προεπεξεργασία δειγμάτων, μέτρηση και στοιχεία - επεξεργασία.


    3) Παραγωγή
    α) κάθε χειριστής πρέπει να κάνει την αυτοεπιθεώρηση των producs και να κάνει τα αντίστοιχα αρχεία επιθεώρησης.
    β) πλήρους απασχόλησης επιθεωρητές μέσω του ελέγχου η αυτοεπιθεώρηση χειριστών, και αναθεώρηση και σημάδι στο αντίστοιχο αρχείο. Η πλήρους απασχόλησης επιθεώρηση είναι αρμόδια για την επιθεώρηση του ολοκληρωμένου προϊόντος, και κάνει το ολοκληρωμένο προϊόν τα εισερχόμενα αρχεία επιθεώρησης.


    4) Πρίν πωλεί
    Το αποτέλεσμα της δοκιμής μπορεί να παρασχεθεί πρίν πωλεί.
    Το όργανο ανίχνευσης τρίτου έχει την άδεια εάν δεν ικανοποιείτε με τα αποτελέσματα της δοκιμής.


    Τα πλεονεκτήματά μας:
    1. Ποιότητα:
    Η επιχείρησή μας είναι μια επαγγελματική παραγωγή των μεσαζόντων ορμονών για πολλά χρόνια, τα προϊόντα μας έχουν εξαγάγει στη Γερμανία, Ισπανία, UK, ΗΠΑ, Αυστραλία, Μέση Ανατολή, και ούτω καθεξής άλλη χώρα, και έχουμε πολύ καλοί ανατροφοδοτούμε από τους πελάτες μας, μπορείτε να μας εμπιστευθείτε.
    Και είμαστε οι manufactory, έτσι κανένα πρόβλημα για μας για να ελέγξουμε την ποιότητα.
    2. Μέθοδος πληρωμής: , TT.
    3. Υπηρεσία: Καλύτερη υπηρεσία με την υπηρεσία μεταπωλήσεων σε όλους τους πελάτες.
    4. Παράδοση:
    Διαταγή δειγμάτων: Η συσκευασία θα σταλεί με 3days μετά από την πληρωμή. Μπορούμε να το στείλουμε μέσω ΕΠΑΝΩ, του EMS, θέση αέρα του HK, DHL ή othermethod. Έχουμε μια επαγγελματική και σταθερή διοικητική μέριμνα, και μπορούμε να παραδώσουμε τη συσκευασία ομαλά περίπου 3 έως 5 ημέρες.


    Άλλο πεπτίδιο ο ανεφοδιασμός εργαστηρίων μας:

    Προϊόν Αγνότητα CAS αριθ.
    Glucagon υδροχλωρίδιο 98% 16941-32-5
    Οξικό άλας Gonadorelin 98% 34973-08-5
    Οξικό άλας Goserelin 98% 145781-92-6
    Ανθρώπινο) οξικό άλας GRF ( 98% 83930-13-6
    Οξικό άλας Hexarelin 98% 140703-51-1
    Οξικό άλας Histrelin 98% 76712-82-8
    Οξικό άλας Icatibant 98% 30308-48-4
    Lanreotide 98% 108736-35-2
    Οξικό άλας Lecirelin (Dalmarelin) 98% 61012-19-9
    Leuprolide 98% 74381-53-6
    Οξικό άλας Leuprorelin 98% 53714-56-0
    Linaclotide Acatate 98% 851199-59-2
    Lixisenatide 98% 320367-13-3
    Lraglutide 98% 204656-20-2
    Οξικό άλας Lysipressin 98% 50-57-7
    Melanotan ΙΙ οξικό άλας 98% 121062-08-6
    MOG (35-55) 98% 163913-87-9
    Οξικό άλας Nafarelin 98% 76932-56-4
    Οξικό άλας Nesiritide (bnp-32) 98% 114471-18-0
    Octreotide 98% 79517-01-4
    Οξικό άλας Ornipressin 98% 3397-23-7
    Oxytocin οξικό άλας 98% 50-56-6
    Palmitoyl Pentapeptide 98% 214047-00-4
    Pexiganan 98% 147664-63-9
    Οξικό άλας Pramlintide 98% 196078-30-5
    Pretirelin    
    PT141 οξικό άλας 98% 32780-32-8
    Calcitonin σολομών οξικό άλας 98% 47931-85-1
    Οξικό άλας Secretin 98% 10813-74-8
    Οξικό άλας Sermorelin 98% 86168-78-7
    Sincalide 98% 25126-32-3
    Οξικό άλας σωματοστατίνης 98% 38916-34-6
    Οξικό άλας Splenopentin 98% 105184-37-0
    Οξικό άλας Taltirelin 98% 103300-74-9
    Οξικό άλας Teriparatide 98% 52232-67-4
    Οξικό άλας Teriparatide 98% 52232-67-4
    Οξικό άλας Terlipressin 98% 14636-12-5
    Οξικό άλας Tetracosactide 98% 16960-16-0
    Thymalfasin 98% 62304-98-7
    Thymopentin 98% 69558-55-0
    Οξικό άλας Thymosin α1 98% 14636-12-5
    Οξικό άλας Thymosin β4 (φυματίωση-500) 98% 77591-33-4
    Οξικό άλας Triptorelin 98% 57773-63-4
    Οξικό άλας Vapreotide 98% 103222-11-3
    Οξικό άλας Vasopressin 98% 9034-50-8
    Οξικό άλας Ziconotide 98% 107452-89-1

     

    Εργαστήριο

    Πεπτίδια cjc-1295 οικοδόμησης μυών χωρίς DAC για Bodybuilders 0

    Πολιτική VIP πελατών:
    Εάν το συνολικό ποσό αγοράς σας στην επιχείρησή μας θα μπορούσε το χρόνο να φθάσει σε 50.000 Δολ ΗΠΑ, στο τέλος του έτους, θα μπορούσαμε να χρησιμοποιήσουμε 2%-5% του συνολικού ποσού για να στείλουμε τα ελεύθερα αγαθά.

    Τύποι πελατών που είχαν περισσότερη υποστήριξη:
    1.Potential πελάτης
    (Με την αγορά του τρεχόντων αριθμού πελατών αγοράς στοιχείων +Clients και της ποσότητας προϊόντων το μήνα για να ισχύσει)

    2.Stable ομάδα πελατών και σταθερή διαταγή ποσότητας το μήνα
    (Με τα πλήρη αγοράζοντας στοιχεία με την επιχείρησή μας που ισχύει)

    3.Regular προσωπικοί χρήστες
    (Με τα πλήρη αγοράζοντας στοιχεία με την επιχείρησή μας που ισχύει)

    4.Clients που έχουν τα κεφάλαια και έχουν το σχέδιο για να επεκτείνουν την αγορά
    (Με την αγορά του τρεχόντων αριθμού πελατών αγοράς στοιχείων +Clients και της ποσότητας προϊόντων το μήνα για να ισχύσει)
    ** Τρέχουσα πραγματική αγορά Data+Future (βασισμένη στο ρεύμα)
     

    Στοιχεία επικοινωνίας
    Passion Technology Development Limited

    Υπεύθυνος Επικοινωνίας: Qin

    Στείλετε το ερώτημά σας απευθείας σε εμάς (0 / 3000)

    Άλλα προϊόντα
    Αίτηση κράτησης

    E-Mail | Sitemap

    Privacy Policy Κίνα καλός ποιότητας Εκχύσιμα πεπτίδια προμηθευτής. © 2018 - 2021 peptide-steroids.com. All Rights Reserved.